Analytical Data
-
Gene name
SMPDL3A
-
简介
SMPDL3A protein hydrolyzes nucleotide triphosphates, particularly ATP, and p-nitrophenyl-TMP. It has limited activity with nucleoside diphosphates and none with nucleoside monophosphates. SMPDL3A also catalyzes the conversion of CDP-choline to CMP and phosphocholine, and CDP-ethanolamine. However, it lacks sphingomyelin phosphodiesterase activity. SMPDL3A Protein, Mouse (HEK293, His) is the recombinant mouse-derived SMPDL3A protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Acid sphingomyelinase-like phosphodiesterase 3a; ASM-like phosphodiesterase 3a; SMPDL3A; ASML3A
-
Species
Mouse
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P70158
-
Expression Region
V23-L445
-
AA Sequence
VPLAPADRAPAVGQFWHVTDLHLDPTYHITDDRTKVCASSKGANASNPGPFGDVLCDSPYQLILSAFDFIKNSGQEASFMIWTGDSPPHVPVPELSTGTVIKVITNMTMTVQNLFPNLQVFPALGNHDYWPQDQLPIVTSKVYSAVADLWKPWLGEEAISTLKKGGFYSQKVASNPGLRIISLNTNLYYGPNIMTLNKTDPANQFEWLENTLNSSLWNKEKVYIIAHVPVGYLPYATDTPAIRQYYNEKLLDIFRRYSSVIAGQFYGHTHRDSLMVLSDKNGNPLNSVFVAPAVTPVKGVLQKETNNPGVRLFQYKPGDYTLLDMVQYYLNLTEANLKGESNWTLEYVLTQAYSVADLQPKSLYALVQQFATKDSKQFLKYYHYYFVSYDSSATCDQHCKTLQVCAIMNLDSMSYDDCLKQHL
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
55-75 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SMPDL3A (Sphingomyelin Phosphodiesterase Acid-Like 3A) is an enzyme involved in sphingolipid metabolism, particularly in the hydrolysis of sphingomyelin to generate bioactive lipid metabolites. Research into SMPDL3A has gained traction due to its potential roles in various physiological and pathological processes, such as cell signaling, tumor progression, and immune responses. Deficiency or dysregulation of SMPDL3A has been associated with several diseases, including cancer and neurodegenerative disorders, highlighting its importance in maintaining cellular homeostasis. Moreover, the enzyme's activity is crucial for the modulation of sphingolipid pathways, which are increasingly recognized for their involvement in metabolic regulation and cellular communication. As a result, the study of recombinant SMPDL3A proteins has become essential for understanding its enzymatic functions and regulatory mechanisms. This research not only aims to elucidate the biological significance of SMPDL3A but also explores its potential as a therapeutic target. By generating and analyzing recombinant forms of SMPDL3A, scientists can dissect its role within cellular contexts, providing insights into how it may be manipulated for future clinical applications. Overall, the exploration of SMPDL3A and its recombinant proteins stands at the intersection of biochemistry and clinical research, seeking to translate basic scientific findings into innovative strategies for disease intervention.
