Analytical Data
-
Gene name
Calmegin/CLGN
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Huamn CLGN at 2 μg/mL (100 μL/Well) can bind Anti-CLGN Antibody. The ED50 for this effect is 0.1 μg/mL. Measured by its binding ability in a functional ELISA. Immobilized Huamn CLGN at 2 μg/mL (100 μL/Well) can bind Anti-CLGN Antibody. The ED50 for this effect is 0.1 μg/mL.
-
Alternative Names
rHuCalmegin, His; Calmegin; CLGN
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
O14967-1
-
Expression Region
E20-W471
-
AA Sequence
EFMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDERAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEGHPWHHHHHH
-
Protein Length
Lumenal Domain
-
Molecular Weight
60-63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Calmegin, also known as CLGN, is a protein primarily expressed in the testis, playing a crucial role in spermatogenesis and fertility. It is a member of the molecular chaperone family, involved in the proper folding and assembly of proteins, particularly in the context of sperm development. Research has uncovered its significance in the maturation of sperm cells and their ability to fertilize oocytes, making it a potential biomarker for male fertility. The study of CLGN has gained attention due to its implications in understanding male reproductive disorders and developing therapeutic strategies for infertility. By producing recombinant forms of Calmegin, researchers aim to explore its functional properties in vitro and in vivo, assess its interactions with other spermatogenic proteins, and understand its role in the male reproductive system more comprehensively. This research not only contributes to basic reproductive biology but also holds promise for clinical applications in treating male infertility, enabling better diagnostic tools and potential interventions to enhance reproductive health.
