Analytical Data
-
Gene name
Carbonic Anhydrase 3
- Application
-
Alternative Names
rHuCarbonic Anhydrase 3, His; Carbonic Anhydrase 3; Carbonate Dehydratase III; Carbonic Anhydrase III; CA3
-
Species
Human
-
Source
E. coli
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
NP_005172.1
-
Expression Region
A1-K260
-
AA Sequence
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
-
Protein Length
Full Length
-
Molecular Weight
28-30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Carbonic Anhydrase 3 (CA3) is a member of the carbonic anhydrase enzyme family, playing a crucial role in the regulation of acid-base balance by catalyzing the reversible reaction between carbon dioxide and water to form bicarbonate and protons. This enzyme is primarily expressed in various tissues, including the kidney, liver, and muscle, and is involved in physiological processes such as respiration, electrolyte balance, and metabolic pathways. Research on recombinant CA3 has gained momentum due to its potential applications in biotechnology and medicine, including the development of biosensors, therapeutic agents for diseases linked to acid-base disturbances, and even as a target for anti-cancer treatments. The ability to produce CA3 in a recombinant form allows for detailed biochemical studies, high-throughput screening for inhibitors, and structural analyses to elucidate the enzyme's function and mechanism. Understanding the structure-function relationship of CA3 can lead to advancements in enzyme engineering and the design of specific inhibitors that could have therapeutic applications. Furthermore, CA3's involvement in pathophysiological conditions such as tumor progression and neurodegenerative diseases highlights the significance of ongoing research in this area. Overall, the study of recombinant Carbonic Anhydrase 3 is essential for expanding our knowledge of its biological roles and harnessing its properties for various scientific and medical advancements.
