Analytical Data
-
Gene name
COMMD9
-
简介
COMMD9 protein regulates the cullin-RING E3 ubiquitin ligase (CRL) complex and regulates ubiquitin-dependent protein degradation. It downregulates NF-kappa-B activation and affects immune and inflammatory responses. COMMD9 Protein, Human (His) is the recombinant human-derived COMMD9 protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Alternative Names
COMM domain-containing protein 9; HSPC166
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9P000-1
-
Expression Region
M1-K198
-
AA Sequence
MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK
-
Protein Length
Full Length of Isoform-1
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COMMD9 (Communications Mediator Protein 9) is a member of the COMMD family of proteins, which are known to participate in various cellular processes, including copper homeostasis, transcriptional regulation, and inflammation. The significance of COMMD9 has been underscored by its association with several diseases, including cancer and genetic disorders, which makes it a potential target for therapeutic interventions. Researchers have observed that COMMD9 interacts with various cellular pathways, such as the NF-κB signaling pathway, suggesting its role in regulating inflammation and immune responses. Given its diverse functions, the study of COMMD9 recombinant protein has gained traction as a way to elucidate its biological mechanisms, explore its role in disease pathogenesis, and evaluate its potential as a biomarker or therapeutic target. The recombinant expression of COMMD9 allows for detailed structural and functional analyses, providing insights into its interactions at the molecular level and its influence on cellular processes. Additionally, understanding the post-translational modifications and regulatory mechanisms of COMMD9 may pave the way for novel strategies in disease management. Overall, the research on COMMD9 recombinant protein is essential for advancing our knowledge of its biological significance and its potential applicability in clinical settings.
