Analytical Data
-
Gene name
Osteomodulin
-
简介
Osteomodulin is a potential contributor to the biomineralization process, exerting its functional role through α(V)β(3)-integrin binding to osteoblasts. This interaction highlights its importance in bone-related cellular activities, affecting osteoblast function and potentially bone formation and remodeling. Osteomodulin Protein, Human (HEK293, His) is the recombinant human-derived Osteomodulin protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Keratan sulfate proteoglycan osteomodulin; OSAD; OMD; SLRR2C
-
Species
Human
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99983
-
Expression Region
Q21-E421
-
AA Sequence
QYETYQWDEDYDQEPDDDYQTGFPFRQNVDYGVPFHQYTLGCVSECFCPTNFPSSMYCDNRKLKTIPNIPMHIQQLYLQFNEIEAVTANSFINATHLKEINLSHNKIKSQKIDYGVFAKLPNLLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLDLCYNYLHDSLLKDKIFAKMEKLMQLNLCSNRLESMPPGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIPRNLEHLYLQNNEIEKMNLTVMCPSIDPLHYHHLTYIRVDQNKLKEPISSYIFFCFPHIHTIYYGEQRSTNGQTIQLKTQVFRRFPDDDDESEDHDDPDNAHESPEQEGAEGHFDLHYYENQE
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
50-70 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Osteomodulin, a small leucine-rich proteoglycan (SLRP), is primarily expressed in bone and cartilage tissues and plays a crucial role in the regulation of extracellular matrix organization and mineralization. Its involvement in bone development and remodeling makes it a significant focus of research in orthopedics and regenerative medicine. Studies have indicated that osteomodulin interacts with collagen and other matrix proteins, contributing to the mechanical properties and structural integrity of bone. Furthermore, it has been linked to various pathological conditions, including osteoporosis and osteoarthritis, where its expression is altered. The recombinant expression of osteomodulin allows for the detailed study of its biological functions and interactions at a molecular level. Researchers aim to produce osteomodulin in vitro, facilitating investigations into its role in cellular processes such as proliferation, differentiation, and mineral deposition. Understanding osteomodulin's function could provide insights into new therapeutic strategies for bone-related diseases and enhance tissue engineering approaches for bone regeneration. The production and characterization of osteomodulin recombinant proteins ultimately pave the way for exploring its potential applications in clinical settings and the development of biomaterials that mimic the natural bone environment.
