Cat: IPD-X25932

Recombinant Human Osteomodulin Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Osteomodulin

  • 简介

    Osteomodulin is a potential contributor to the biomineralization process, exerting its functional role through α(V)β(3)-integrin binding to osteoblasts. This interaction highlights its importance in bone-related cellular activities, affecting osteoblast function and potentially bone formation and remodeling. Osteomodulin Protein, Human (HEK293, His) is the recombinant human-derived Osteomodulin protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Keratan sulfate proteoglycan osteomodulin; OSAD; OMD; SLRR2C

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q99983

  • Expression Region

    Q21-E421

  • AA Sequence

    QYETYQWDEDYDQEPDDDYQTGFPFRQNVDYGVPFHQYTLGCVSECFCPTNFPSSMYCDNRKLKTIPNIPMHIQQLYLQFNEIEAVTANSFINATHLKEINLSHNKIKSQKIDYGVFAKLPNLLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLDLCYNYLHDSLLKDKIFAKMEKLMQLNLCSNRLESMPPGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLPNIVELSVGHNKLKQAFYIPRNLEHLYLQNNEIEKMNLTVMCPSIDPLHYHHLTYIRVDQNKLKEPISSYIFFCFPHIHTIYYGEQRSTNGQTIQLKTQVFRRFPDDDDESEDHDDPDNAHESPEQEGAEGHFDLHYYENQE

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    50-70 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Osteomodulin, a small leucine-rich proteoglycan (SLRP), is primarily expressed in bone and cartilage tissues and plays a crucial role in the regulation of extracellular matrix organization and mineralization. Its involvement in bone development and remodeling makes it a significant focus of research in orthopedics and regenerative medicine. Studies have indicated that osteomodulin interacts with collagen and other matrix proteins, contributing to the mechanical properties and structural integrity of bone. Furthermore, it has been linked to various pathological conditions, including osteoporosis and osteoarthritis, where its expression is altered. The recombinant expression of osteomodulin allows for the detailed study of its biological functions and interactions at a molecular level. Researchers aim to produce osteomodulin in vitro, facilitating investigations into its role in cellular processes such as proliferation, differentiation, and mineral deposition. Understanding osteomodulin's function could provide insights into new therapeutic strategies for bone-related diseases and enhance tissue engineering approaches for bone regeneration. The production and characterization of osteomodulin recombinant proteins ultimately pave the way for exploring its potential applications in clinical settings and the development of biomaterials that mimic the natural bone environment.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US