Cat: IPD-X25759

Recombinant Cynomolgus 14-3-3 beta Protein

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    14-3-3 beta

  • 简介

    14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    KCIP-1; 14-3-3 protein beta/alpha; GW128; Protein 1054; YWHAB

  • Species

    Cynomolgus

  • Source

    E. coli

  • Tag

    Tag Free

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q4R572-2

  • Expression Region

    M1-N244

  • AA Sequence

    MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

  • Protein Length

    Full Length of Isoform-2

  • Molecular Weight

    28 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

14-3-3 proteins are a family of highly conserved regulatory molecules that play a crucial role in various cellular processes, including signal transduction, cell cycle regulation, and apoptosis. Among these, the 14-3-3 beta isoform has garnered significant interest due to its involvement in cognitive function and neurodevelopment. Dysregulation of 14-3-3 beta has been implicated in several neurodegenerative disorders and psychiatric conditions, making it a potential therapeutic target. Research has shown that 14-3-3 beta interacts with numerous client proteins, modulating their stability and activity, which highlights its significance in maintaining cellular homeostasis. The recombinant expression of 14-3-3 beta in various cellular systems allows for detailed studies of its structure-function relationships and interaction networks. These studies contribute to our understanding of how 14-3-3 beta influences cellular signaling pathways and cellular responses to stress, which is critical for developing targeted therapies. The exploration of 14-3-3 beta in both normal physiology and disease states represents a promising avenue for advancing medical research and therapeutic interventions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US