Analytical Data
-
Gene name
14-3-3 beta
-
简介
14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.
- Application
-
Alternative Names
KCIP-1; 14-3-3 protein beta/alpha; GW128; Protein 1054; YWHAB
-
Species
Cynomolgus
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q4R572-2
-
Expression Region
M1-N244
-
AA Sequence
MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
-
Protein Length
Full Length of Isoform-2
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
14-3-3 proteins are a family of highly conserved regulatory molecules that play a crucial role in various cellular processes, including signal transduction, cell cycle regulation, and apoptosis. Among these, the 14-3-3 beta isoform has garnered significant interest due to its involvement in cognitive function and neurodevelopment. Dysregulation of 14-3-3 beta has been implicated in several neurodegenerative disorders and psychiatric conditions, making it a potential therapeutic target. Research has shown that 14-3-3 beta interacts with numerous client proteins, modulating their stability and activity, which highlights its significance in maintaining cellular homeostasis. The recombinant expression of 14-3-3 beta in various cellular systems allows for detailed studies of its structure-function relationships and interaction networks. These studies contribute to our understanding of how 14-3-3 beta influences cellular signaling pathways and cellular responses to stress, which is critical for developing targeted therapies. The exploration of 14-3-3 beta in both normal physiology and disease states represents a promising avenue for advancing medical research and therapeutic interventions.
