Analytical Data
-
Gene name
Biglycan
-
简介
Biglycan proteins may be involved in collagen fiber assembly, suggesting a role in organizing and building collagen networks. Its involvement suggests a crucial function in extracellular matrix formation and maintenance. Biglycan Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Biglycan protein, expressed by HEK293 , with C-hFc labeled tag.
- Application
-
Biological Activity
Measured by its ability to inhibit the cell growth of mouse NIH-3T3 mouse embryonic fibroblast adipose-like cells. The ED50 for this effect is 0.5711 μg/mL, corresponding to a specific activity is 1.751×103units/mg. Measured by its ability to inhibit the cell growth of mouse NIH-3T3 mouse embryonic fibroblast adipose-like cells. The ED50 for this effect is 0.5711 μg/mL, corresponding to a specific activity is 1.751×103 units/mg.
-
Alternative Names
Biglycan; BGN; SLRR1A
-
Species
Mouse
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P28653
-
Expression Region
D38-K369
-
AA Sequence
DEEASGSDTTSGVPDLDSVTPTFSAMCPFGCHCHLRVVQCSDLGLKTVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHSNNITKVGINDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
75-100 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Biglycan is a small leucine-rich proteoglycan that plays a crucial role in the regulation of collagen fibril formation and the maintenance of extracellular matrix integrity. As a member of the small leucine-rich proteoglycan family, it is primarily found in connective tissues and has been implicated in various biological processes, including wound healing, inflammation, and tumor progression. Research on recombinant biglycan protein has gained significance due to its potential therapeutic applications in regenerative medicine and tissue engineering. By studying recombinant biglycan, scientists aim to elucidate its structural properties and functional roles in the extracellular matrix, which may pave the way for developing novel biomaterials that enhance tissue regeneration. Additionally, understanding the molecular mechanisms by which biglycan interacts with other extracellular matrix components can provide insights into the pathophysiology of various diseases, including osteoarthritis and cancer. As such, the development of recombinant biglycan not only offers opportunities for advanced biomaterial design but also opens up new avenues for targeted therapies that exploit its unique properties in modulating cellular behavior and tissue repair.
