Cat: IPD-X25750

Recombinant Mouse Calnexin Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Calnexin

  • 简介

    Calnexin interacts with monoglucosylated glycoproteins, helping their assembly and retention in the endoplasmic reticulum (ER). Calnexin Protein, Mouse (HEK293, His) is the recombinant mouse-derived Calnexin protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its ability to enhance the proliferation of SH-SY5Y cells. The ED50 for this effect is 10.92 ng/mL in the presence of 0.5 μg/mL PRNP, corresponding to a specific activity is 9.158×104 units/mg. Measured by its ability to enhance the proliferation of SH-SY5Y cells. The ED50 for this effect is 10.92 ng/mL in the presence of 0.5 μg/mL PRNP, corresponding to a specific activity is 9.158×104 units/mg.

  • Alternative Names

    Calnexin; IP90; Major Histocompatibility Complex Class I Antigen-Binding Protein p88; CANX

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-10*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P35564

  • Expression Region

    H21-P482

  • AA Sequence

    HDGHDDDAIDIEDDLDDVIEEVEDSKSKSDASTPPSPKVTYKAPVPTGEVYFADSFDRGSLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTAELSLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAVKPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPFSAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVLQMLEAAEERP

  • Protein Length

    Lumenal Domain

  • Molecular Weight

    58-70 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Calnexin is a membrane-associated chaperone protein predominantly found in the endoplasmic reticulum (ER), playing a critical role in the proper folding and quality control of newly synthesized glycoproteins. Its unique structure, featuring a lectin domain that recognizes specific carbohydrate moieties on nascent glycoproteins, enables it to assist in their proper folding and prevent aggregation. Research has shown that Calnexin interacts with a variety of client proteins, influencing their stability, functionality, and transport to the Golgi apparatus. Given its essential role in the protein maturation process, Calnexin has garnered significant interest in studies related to various diseases, including neurodegenerative disorders, where protein misfolding is a key feature. Additionally, its involvement in the immune response and cellular stress response pathways underscores its importance in maintaining cellular homeostasis. Research on recombinant Calnexin has advanced our understanding of its mechanistic functions and potential therapeutic roles, paving the way for novel strategies to address diseases associated with protein misfolding and ER stress. By investigating the protein's structure-function relationships and interaction networks through recombinant expression systems, researchers aim to develop targeted therapeutics that can modulate Calnexin's activity, thereby enhancing protein folding processes in pathological conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US