Analytical Data
-
Gene name
BIN1
-
简介
The BIN1 protein is essential for controlling plasma membrane curvature and shape and is essential for the formation of T-tubules in muscle cells. It acts as a negative regulator of endocytosis and affects intracellular vesicle sorting. BIN1 Protein, Human (His) is the recombinant human-derived BIN1 protein, expressed by E. coli , with N-His labeled tag.
- Application
-
Alternative Names
Myc box-dependent-interacting protein 1; BIN1; AMPHL; Amphiphysin II
-
Species
Human
-
Source
E. coli
-
Tag
N-10*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00499-10
-
Expression Region
M1-P424
-
AA Sequence
MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPRKKSKLFSRLRRKKNSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
-
Protein Length
Full Length of Isoform-10
-
Molecular Weight
54 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BIN1 (Bridging Integrator 1) is a vital membrane-associated protein that plays crucial roles in various cellular processes, including endocytosis, cytoskeleton remodeling, and intracellular signaling. The significance of BIN1 has gained attention in recent years due to its involvement in muscular dystrophies and certain types of cancer. Studies have demonstrated that BIN1 interacts with other proteins and cellular components, affecting processes such as membrane dynamics and cellular differentiation. Furthermore, alternative splicing of the BIN1 gene leads to multiple isoforms, each exhibiting distinct functional properties. Research on BIN1 recombinant proteins focuses on elucidating the structure-function relationships of these isoforms, which can provide insights into their biological roles and therapeutic potential. Understanding BIN1's mechanisms of action at the molecular level is crucial for developing targeted therapies for BIN1-related diseases, as well as potentially leveraging its functions in regenerative medicine and cancer treatment.
