Analytical Data
-
Gene name
UDP-glucose 4-epimerase/GALE
-
简介
GALE proteins catalyze the reversible epimerization of UDP-glucose to UDP-galactose, and the reversible epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. UDP-glucose 4-epimerase/GALE Protein, Human (His) is the recombinant human-derived UDP-glucose 4-epimerase/GALE protein, expressed by E. coli , with N-6*His labeled tag.
- Application
-
Alternative Names
rHuUDP-glucose 4-epimerase/GALE, His; UDP-Glucose 4-Epimerase; Galactowaldenase; UDP-Galactose 4-Epimerase; GALE
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q14376-1
-
Expression Region
M1-A348
-
AA Sequence
MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
-
Protein Length
Full Length of Isoform-1
-
Molecular Weight
38.23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
UDP-glucose 4-epimerase, also known as GALE (galactose epimerase), is a vital enzyme that plays a crucial role in carbohydrate metabolism by catalyzing the reversible conversion between UDP-galactose and UDP-glucose. This reaction is pivotal in the galactose biochemical pathway, influencing various physiological processes such as glycoprotein synthesis and energy metabolism. Deficiency in GALE activity can lead to galactosaemia, a metabolic disorder characterized by the accumulation of galactose in the body, which can result in severe complications if left untreated. Due to its clinical significance, the study of GALE has garnered interest for potential therapeutic applications. The recombinant expression of GALE in host systems allows for detailed structural and functional studies, enabling researchers to explore its catalytic mechanisms, substrate specificity, and regulatory roles in metabolism. Additionally, understanding GALE's structure can aid in the design of inhibitors or modulators for therapeutic purposes, particularly in managing galactose-related disorders. Thus, the production and analysis of recombinant GALE not only deepen our understanding of its biological functions but also pave the way for innovative treatment strategies in metabolic diseases.
