Analytical Data
-
Gene name
p38 alpha/MAPK14
-
简介
The p38 gamma/MAPK12 protein is an important serine/threonine kinase in the MAP kinase pathway and can respond to extracellular stimuli such as pro-inflammatory cytokines or stress. p38 MAPK activates transcription factors such as ELK1 and ATF2, each of which phosphorylates approximately 200 to 300 substrates. p38 gamma/MAPK12 Protein, Human (Active, sf9, GST) is the recombinant human-derived p38 gamma/MAPK12 protein, expressed by Sf9 insect cells, with N-GST labeled tag.
- Application
-
Alternative Names
Mitogen-activated protein kinase 12; MAP kinase 12; MAPK 12; Extracellular signal-regulated kinase 6 (ERK-6); Mitogen-activated protein kinase p38 gamma (MAP kinase p38 gamma); Stress-activated protein kinase 3
-
Species
Human
-
Source
Baculovirus
-
Tag
N-GST
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P53778-1
-
Expression Region
S2-L367
-
AA Sequence
SSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL
-
Protein Length
Partial
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
p38 alpha/MAPK14 is a crucial member of the mitogen-activated protein kinase (MAPK) family, playing a significant role in cellular responses to stress, inflammation, and cell differentiation. It is activated by various extracellular stimuli, including pro-inflammatory cytokines and stress signals, leading to the phosphorylation of numerous downstream targets involved in gene expression, cell cycle regulation, and apoptosis. Given its involvement in critical physiological and pathological processes, such as cancer, neurodegenerative diseases, and autoimmune disorders, p38 alpha has emerged as a promising therapeutic target. Research into recombinant p38 alpha/MAPK14 proteins has facilitated the elucidation of its structural and functional properties, enabling the development of specific inhibitors that could modulate its activity in disease contexts. Understanding the signaling pathways and interactions mediated by p38 alpha is essential for designing novel treatments aimed at harnessing its regulatory functions in cellular processes. Additionally, recombinant proteins provide a valuable tool for studying the precise mechanisms of p38 alpha activation and its role in different biological systems, laying the groundwork for future therapeutic interventions.
