Recombinant Human 40S Ribosomal 蛋白 S3/RPS3 Protein，His

40S Ribosomal 蛋白 S3/RPS3

40S ribosomal protein S3 (RPS3) is an important component of the small ribosomal subunit and is integral to cellular protein synthesis. In addition to its ribosomal function, RPS3 exhibits endonuclease activity and plays a role in DNA repair. 40S Ribosomal Protein S3/RPS3 Protein, Human (His) is the recombinant human-derived 40S Ribosomal protein S3/RPS3 protein, expressed by E. coli , with C-His labeled tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

IMR 90 ribosomal protein S3

Human

E. coli

C-His

Greater than 90% as determined by SDS-PAGE.

P23396-1

A2-A243

AVQISKKRKFVADGIFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA

Full Length of Isoform-1 Mature Protein

32 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.