Cat: IPD-X25345

Recombinant Rat p53 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    p53

  • 简介

    The p53 protein acts as a tumor suppressor, regulates the cell cycle and induces growth arrest or apoptosis.It activates genes that inhibit cell division and trigger apoptosis by controlling the expression of various proteins.p53 Protein, Rat (His) is the recombinant rat-derived p53 protein, expressed by E.coli , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Tp53; P53; Cellular tumor antigen p53; Tumor suppressor p53

  • Species

    Rat

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P10361

  • Expression Region

    M1-D391

  • AA Sequence

    MEDSQSDMSIELPLSQETFSCLWKLLPPDDILPTTATGSPNSMEDLFLPQDVAELLEGPEEALQVSAPAAQEPGTEAPAPVAPASATPWPLSSSVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSISLNKLFCQLAKTCPVQLWVTSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNPYAEYLDDRQTFRHSVVVPYEPPEVGSDYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEEHCPELPPGSAKRALPTSTSSSPQQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKDARAAEESGDSRAHSSYPKTKKGQSTSRHKKPMIKKVGPDSD

  • Protein Length

    Full Length

  • Molecular Weight

    50 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The p53 protein, often referred to as the "guardian of the genome," plays a crucial role in regulating the cell cycle and maintaining genomic stability. It is encoded by the TP53 gene and acts as a tumor suppressor, preventing the proliferation of cells with damaged DNA. Mutations in the TP53 gene are found in approximately half of all human cancers, underscoring its significance in cancer biology. Research into p53 has gained momentum due to its pivotal role in regulating apoptosis, DNA repair, and cellular senescence. Recombinant p53 protein has been developed for various applications, including studying its functional mechanisms, developing cancer therapies, and designing targeted treatments that restore the activity of mutated forms of p53. Furthermore, innovative techniques such as CRISPR/Cas9 genome editing are being explored to create cellular models that express mutated p53, enhancing our understanding of its role in tumorigenesis. The characterization and application of recombinant p53 allow researchers to elucidate its biochemical pathways and interactions with other cellular proteins, offering insights into potential therapeutic strategies to combat cancers associated with p53 dysfunction. Overall, p53 and its recombinant protein derivatives represent a vital area of research in oncology, with the potential to transform cancer treatment paradigms and improve patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US