Cat: IPD-X25319

Recombinant Human TEAD3 Protein,His & SUMO

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TEAD3

  • 简介

    TEAD3 protein is a transcription factor that plays a key role in the Hippo signaling pathway and is essential for organ size control and tumor suppression. It coordinates proliferation inhibition and apoptosis promotion through a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1. TEAD3 Protein, Human (His-SUMO) is the recombinant human-derived TEAD3 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DTEF 1; DTEF-1; DTEF1; ETFR 1; ETFR1; TEA domain family member 3; TEA domain family member 5; TEAD 3; TEAD-3; Tead3; TEAD5; TEF 5; TEF5; Transcriptional enhancer factor 5

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-SUMO;N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q99594

  • Expression Region

    M112-D435

  • AA Sequence

    MNLDQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD

  • Protein Length

    Partial

  • Molecular Weight

    52.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TEAD3 (TEA Domain Transcription Factor 3) is a member of the TEAD family of transcription factors, which play crucial roles in regulating gene expression involved in diverse biological processes such as development, cell growth, and differentiation. TEAD3, in particular, has gained attention due to its involvement in the Hippo signaling pathway, which is critical for controlling organ size and preventing tumorigenesis. Dysregulation of TEAD3 has been linked to various cancers, making it a potential target for therapeutic intervention. The study of recombinant TEAD3 protein is vital for understanding its structural and functional properties, specifically its interactions with other proteins and its role in transcriptional regulation. Researchers utilize recombinant techniques to produce TEAD3 in vitro, allowing for detailed assays to assess its binding affinity to DNA and other cofactors, elucidating its mechanism of action. Furthermore, studying TEAD3 in a laboratory setting can provide insights into its potential as a biomarker for cancer diagnosis and a target for novel treatments. As the understanding of TEAD3's functions deepens, it opens new avenues for research in cancer biology and regenerative medicine, highlighting the importance of this protein in both developmental and pathological contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US