Analytical Data
-
Gene name
CDC42
-
简介
CDC42 is a plasma membrane-associated small GTPase that regulates cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. It participates in epithelial cell polarization, regulates the attachment of spindle microtubules to kinetochores, affects cell migration, and plays a key role in the formation of filopodia. CDC42 Protein, Human (Active, GST-His) is the recombinant human-derived CDC42 protein, expressed by E. coli, with N-His and N-GST labeled tag.
- Application
-
Alternative Names
CDC42; Cell division control protein 42 homolog; G25K GTP-binding protein
-
Species
Human
-
Source
E. coli
-
Tag
N-His;N-GST
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P60953-2
-
Expression Region
M1-L191
-
AA Sequence
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL
-
Protein Length
Full Length
-
Molecular Weight
48 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Cdc42, a member of the Rho family of small GTPases, plays a crucial role in regulating various cellular processes, including cell cycle progression, cytoskeletal dynamics, and cell signaling. As a molecular switch, Cdc42 oscillates between an active, GTP-bound state and an inactive, GDP-bound state, which is regulated by guanine nucleotide exchange factors (GEFs) and GTPase-activating proteins (GAPs). Its dysregulation is implicated in several pathophysiological conditions, including cancer metastasis, where it promotes cell migration and invasion. The study of recombinant Cdc42 protein has provided valuable insights into its functional mechanisms and interactions with downstream effectors, such as PAK proteins and WASP, which are critical in actin polymerization and formation of cellular structures. Recombinant Cdc42 is typically produced in bacterial expression systems, allowing researchers to obtain large quantities of the protein for biochemical and structural studies. This research is pivotal for understanding Cdc42's role in normal physiology and disease states, potentially unveiling novel therapeutic targets for cancer and other disorders linked to Cdc42 malfunction. With advancements in protein engineering and assay development, studies employing recombinant Cdc42 are enhancing our comprehension of its mechanisms of action, providing foundational knowledge for future drug design and therapeutic interventions targeting Cdc42-related pathways.











