Cat: IPD-X29582

Recombinant Human LIN28A Protein,His & SUMO

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LIN28A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Protein lin-28 homolog A; LIN28A; Zinc finger CCHC domain-containing protein 1; CSDD1; LIN28; ZCCHC1

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6*His;N-SUMO

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H9Z2

  • Expression Region

    M1-N209

  • AA Sequence

    MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN

  • Protein Length

    Full Length

  • Molecular Weight

    40-45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LIN28A is a well-characterized member of the LIN28 family of proteins, which play pivotal roles in regulating developmental and cellular processes, particularly in the context of stem cell biology and differentiation. Initially discovered for its involvement in the regulation of let-7 microRNA biogenesis, LIN28A has gained attention for its role in promoting the pluripotency of stem cells and influencing various cellular pathways, including metabolism and growth. Research has shown that LIN28A expression is elevated in various tumors, suggesting its potential as an oncogene. The study of LIN28A recombinant protein has become crucial for elucidating its mechanisms of action in both normal and pathological states. By producing and analyzing this protein, researchers aim to further understand its interactions with RNA and other cellular partners, contributing to the understanding of its role in cancer progression and potential therapeutic implications. The investigation of LIN28A also opens avenues for developing targeted treatments in regenerative medicine and oncology, highlighting the significance of understanding reprogramming factors in cellular fate determination.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US