Analytical Data
-
Gene name
DPEP3
- Application
-
Alternative Names
UNQ834; PRO1772; Dipeptidase 3; DPEP3
-
Species
Human
-
Source
HEK293
-
Tag
C-10*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H4B8
-
Expression Region
A36-S463
-
AA Sequence
AETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRS
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
48.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DPEP3, or dipeptidase 3, is a member of the dipeptidase family of enzymes, which are involved in the hydrolysis of dipeptides into free amino acids. The study of DPEP3 has gained considerable attention due to its potential role in various physiological and pathological processes, including inflammation, cancer progression, and metabolic disorders. Research indicates that DPEP3 may influence the efficiency of peptide metabolism and, consequently, affect the availability of amino acids that are crucial for protein synthesis and cell signaling. Furthermore, variations in DPEP3 expression levels have been associated with certain diseases, suggesting its involvement in cellular pathways that regulate tissue homeostasis and immune responses. Understanding the structure, function, and regulatory mechanisms of DPEP3 at a molecular level can provide insights into its biological significance and therapeutic potential. Recent studies have focused on the recombinant expression of DPEP3 to explore its enzymatic properties and interactions with substrates, thereby laying the groundwork for developing DPEP3-targeted therapeutics. By elucidating the role of DPEP3 in disease processes, researchers aim to harness this enzyme for novel treatment strategies, which could lead to improved management of conditions related to dysregulated peptide metabolism.
