Analytical Data
-
Gene name
Animal-Free HMGB1/HMG-1
-
简介
HMGB1, or high mobility group box 1, is a protein that plays a role in various cellular processes. It has different functionalities depending on its redox state and location within the cell. Animal-Free HMGB1/HMG-1 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeHMGB1/HMG-1 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
- Application
-
Alternative Names
HMG-1; Hmg1; SBP; SBP-1; amph; p3; p30
-
Species
Mouse
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P63158
-
Expression Region
M1-E215
-
AA Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
-
Protein Length
Full Length
-
Molecular Weight
25.56 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
High-mobility group box 1 (HMGB1) is a non-histone nuclear protein that plays a crucial role in various biological processes, including DNA repair, gene expression, and inflammation. As a damage-associated molecular pattern (DAMP), HMGB1 is released by dying cells and contributes to the pathogenesis of numerous diseases, such as sepsis, cancer, and autoimmune disorders. Traditionally, HMGB1 was sourced from animal tissues, which raised concerns about variability, ethical issues, and the risk of contamination with pathogens. Recent advancements in recombinant DNA technology have facilitated the production of animal-free HMGB1/HMG-1 proteins using microbial expression systems. This approach not only ensures a consistent and high-purity product but also addresses ethical concerns associated with animal-derived proteins. The development of animal-free recombinant HMGB1 has significant implications for both basic research and therapeutic applications. It enables researchers to explore the protein’s functional roles in a controlled manner and paves the way for potential therapeutic interventions targeting HMGB1-driven pathways. Furthermore, it offers a promising avenue for generating HMGB1-based diagnostics and treatments without the complications of animal-derived products, thereby advancing our understanding of its biology and reducing the reliance on animal sources. Overall, the synthesis of animal-free HMGB1/HMG-1 recombinant proteins marks a significant step forward in biomedical research, providing a reliable and ethical means to study this important protein and its implications for health and disease.
