Analytical Data
-
Gene name
Animal-Free HMGB2/HMG-2
-
简介
The multifunctional HMGB2/HMG-2 protein exhibits multiple cellular functions and may function in a redox-sensitive manner. In the nucleus, it acts as a chromatin-associated non-histone protein that is essential for transcription, chromatin remodeling and V(D)J reorganization. Animal-Free HMGB2/HMG-2 Protein, Human (His) is the recombinant human-derived animal-FreeHMGB2/HMG-2 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
- Application
-
Alternative Names
High Mobility Group Protein B2; High Mobility Group Protein 2; HMG-2; HMGB2; HMG2
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P26583
-
Expression Region
M1-E209
-
AA Sequence
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE
-
Protein Length
Full Length
-
Molecular Weight
24.84 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TPBG (Trophectoderm Protein Beta Gene) and its variant 5T4 are tumor-associated antigens that have garnered significant attention in cancer research. Initially identified as a marker for the trophoblast tissue during early embryonic development, TPBG/5T4 expression has been found to be upregulated in various malignancies, including colorectal, lung, and breast cancers. This aberrant expression pattern makes TPBG/5T4 a promising target for immunotherapy and cancer diagnostics. Researchers have been investigating its role in tumorigenesis, particularly how it contributes to the immune evasion of cancer cells. Additionally, studies are focused on developing monoclonal antibodies and vaccines aimed at enhancing the immune response against tumors expressing TPBG/5T4. The potential for TPBG/5T4 to serve as both a biomarker for early detection and a target for targeted therapy underlines its significance in the development of personalized cancer treatment strategies. Ongoing research aims to elucidate the mechanisms governing TPBG/5T4 expression in tumors, explore its interaction with various immune pathways, and assess its efficacy in clinical settings. Collectively, this line of research holds the promise of improving therapeutic outcomes for patients with cancers that exhibit TPBG/5T4 expression.











