Cat: IPD-X25010

Recombinant Human Animal-Free HMGB2/HMG-2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Animal-Free HMGB2/HMG-2

  • 简介

    The multifunctional HMGB2/HMG-2 protein exhibits multiple cellular functions and may function in a redox-sensitive manner. In the nucleus, it acts as a chromatin-associated non-histone protein that is essential for transcription, chromatin remodeling and V(D)J reorganization. Animal-Free HMGB2/HMG-2 Protein, Human (His) is the recombinant human-derived animal-FreeHMGB2/HMG-2 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    High Mobility Group Protein B2; High Mobility Group Protein 2; HMG-2; HMGB2; HMG2

  • Species

    Human

  • Source

    E. coli

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P26583

  • Expression Region

    M1-E209

  • AA Sequence

    MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE

  • Protein Length

    Full Length

  • Molecular Weight

    24.84 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TPBG (Trophectoderm Protein Beta Gene) and its variant 5T4 are tumor-associated antigens that have garnered significant attention in cancer research. Initially identified as a marker for the trophoblast tissue during early embryonic development, TPBG/5T4 expression has been found to be upregulated in various malignancies, including colorectal, lung, and breast cancers. This aberrant expression pattern makes TPBG/5T4 a promising target for immunotherapy and cancer diagnostics. Researchers have been investigating its role in tumorigenesis, particularly how it contributes to the immune evasion of cancer cells. Additionally, studies are focused on developing monoclonal antibodies and vaccines aimed at enhancing the immune response against tumors expressing TPBG/5T4. The potential for TPBG/5T4 to serve as both a biomarker for early detection and a target for targeted therapy underlines its significance in the development of personalized cancer treatment strategies. Ongoing research aims to elucidate the mechanisms governing TPBG/5T4 expression in tumors, explore its interaction with various immune pathways, and assess its efficacy in clinical settings. Collectively, this line of research holds the promise of improving therapeutic outcomes for patients with cancers that exhibit TPBG/5T4 expression.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US