Analytical Data
-
Gene name
Galectin-4/LGALS4
-
简介
Galectin-4/LGALS4 is a lactose-binding galectin protein with affinity for a variety of sugars. It is associated with the formation of adherens junctions, suggesting its potential role in cell adhesion processes. Galectin-4/LGALS4 Protein, Human (His) is the recombinant human-derived Galectin-4/LGALS4 protein, expressed by E. coli , with C-6*His labeled tag.
- Application
-
Alternative Names
Galectin-4; Gal-4; L36LBP; Antigen NY-CO-27; LGALS4
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P56470
-
Expression Region
M1-I323
-
AA Sequence
MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRCGLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI
-
Protein Length
Full Length
-
Molecular Weight
35-38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Galectin-4 (LGALS4) is a member of the galectin family, which are β-galactoside-binding proteins implicated in various biological processes such as cell adhesion, migration, proliferation, and apoptosis. Research surrounding Galectin-4 has gained momentum due to its significant role in several pathological conditions, including cancer progression, inflammatory responses, and autoimmune diseases. It is predominantly expressed in epithelial tissues, particularly in the gastrointestinal tract and the pancreas, suggesting its involvement in mucosal immunity and tissue homeostasis. The exploration of Galectin-4 as a potential biomarker for disease diagnosis and prognosis has been a focal point in recent studies. Additionally, scientists are investigating its therapeutic applications, as targeting Galectin-4 could modulate disease outcomes, especially in tumor microenvironments where it influences immune cell interactions. The recombinant expression of Galectin-4 facilitates detailed studies of its biological functions, interactions with other biomolecules, and its structural properties. Understanding the complex mechanisms by which Galectin-4 operates may unveil novel strategies for intervention in diseases where it plays a critical role. This research not only contributes to the broader understanding of galectins in health and disease but also paves the way for the development of innovative therapeutic approaches that leverage the unique properties of Galectin-4.











