Analytical Data
-
Gene name
ST8SIA1
-
简介
The ST8SIA1 protein links sialic acid to ganglioside GM3 via an α 2,8-bond to form ganglioside GD3. ST8SIA1 Protein, Human (HEK293, His) is the recombinant human-derived ST8SIA1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
Alpha-N-Acetylneuraminide Alpha-2; 8-Sialyltransferase; Alpha-2; 8-Sialyltransferase 8A; Ganglioside GD3 Synthase; Ganglioside GT3 Synthase; Sialyltransferase 8A; SIAT8-A; Sialytransferase St8Sia I; ST8SiaI; ST8SIA1; SIAT8; SIAT8A
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92185
-
Expression Region
Y49-S356
-
AA Sequence
YRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVAIYGFWPFSVNMHEQPISHHYYDNVLPFSGFHAMPEEFLQLWYLHKIGALRMQLDPCEDTSLQPTS
-
Protein Length
Lumenal Domain
-
Molecular Weight
48 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ST8SIA1, also known as α2,8-sialyltransferase 1, is an enzyme involved in the biosynthesis of polysialic acid, a crucial component of the neural cell adhesion molecule (NCAM). This polysaccharide plays a significant role in various biological processes including cell adhesion, migration, and plasticity, particularly during neural development and in response to injury. Alterations in ST8SIA1 expression and activity have been implicated in neurodevelopmental disorders, neurodegenerative diseases, and certain cancers. Recent research emphasizes the importance of ST8SIA1 in modulating cellular interactions and signaling pathways that govern neurogenesis and synaptic plasticity. The study of ST8SIA1-recombinant proteins has become pivotal in understanding its functional properties and therapeutic potential. By creating recombinant forms of ST8SIA1, researchers aim to elucidate the structural and functional mechanisms underlying polysialic acid synthesis and its effects on cellular behavior. Moreover, the investigation of ST8SIA1 is expanding into fields such as regenerative medicine, where its role in enhancing neuronal survival and growth is being explored. As such, understanding the intricacies of ST8SIA1 not only provides insights into fundamental neurobiology but also holds promise for developing targeted therapies for disorders associated with impaired polysialylation.
