Analytical Data
-
Gene name
PRPS1
-
简介
The PRPS1 protein plays a crucial role in catalyzing the synthesis of phosphoribosyl pyrophosphate (PRPP), a key intermediate in nucleotide synthesis. By promoting the conversion of ribose 5-phosphate and ATP to PRPP, PRPS1 contributes to the availability of PRPP in various cellular processes, including de novo biosynthesis of purine and pyrimidine nucleotides. PRPS1 Protein, Human (His-SUMO) is the recombinant human-derived PRPS1 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
- Application
-
Alternative Names
PRPS1; phosphoribosyl pyrophosphate synthetase 1; deafness, X linked 2, perceptive, congenital , DFN2; ribose-phosphate pyrophosphokinase 1; CMTX5; DFNX1; PRS I; ribose phosphate diphosphokinase 1;
-
Species
Human
-
Source
E. coli
-
Tag
N-SUMO;N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P60891-1
-
Expression Region
P2-L318
-
AA Sequence
PNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIRENISEWRNCTIVSPDAGGAKRVTSIADRLNVDFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATRVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQEDKMKHCSKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRPS1, or phosphoribosyl pyrophosphate synthetase 1, is an essential enzyme in the purine biosynthetic pathway, catalyzing the formation of phosphoribosyl pyrophosphate (PRPP) from ribose-5-phosphate and ATP. Mutations in the PRPS1 gene can lead to various genetic disorders, most notably X-linked nonsyndromic intellectual disability and type 3 phosphoribosyl pyrophosphate synthetase superactivity, which are characterized by elevated PRPP levels and subsequent metabolic dysfunction. Research into PRPS1 recombinant protein has gained significant interest due to its critical role in nucleotide biosynthesis and implications in cellular metabolism. The study of PRPS1 not only enhances our understanding of purine metabolism but also aids in the development of therapeutic interventions for associated disorders. Recombinant PRPS1 allows for the investigation of its enzymatic properties, regulation, and potential interactions with small molecules, paving the way for targeted treatments. Furthermore, elucidating the structure-function relationship of PRPS1 through recombinant expression can provide insights into the mechanisms of enzymatic action and the effects of specific mutations, offering valuable information for future drug design and therapeutic strategies. Overall, the exploration of PRPS1 recombinant protein serves as a crucial step toward unraveling the complexities of purine metabolism and its connections to human health.
