Cat: IPD-X24825

Recombinant Human LRG1 Protein (HEK293),hFc & His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LRG1

  • 简介

    Leucine-rich alpha-2-glycoprotein (encoded by LRG1) is a serum biomarkerof inflammatory bowel disease and various autoimmune diseases. LRG1 can bind to TGF-β1 (KD: 2.32 µM) and modulate the TGFβ pathway[1][2][3]. LRG1 Protein, Human (HEK293, Fc-His) is the recombinant human-derived LRG1 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Cytochrome c is immobilized at 1µg/mL(100 µL/well) can bind Biotinylated Human LRG1. The ED50 for this effect is 8.019 ng/mL. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Cytochrome c is immobilized at 1µg/mL(100 µL/well) can bind Biotinylated Human LRG1. The ED50 for this effect is 8.019 ng/mL.

  • Alternative Names

    rHuLeucine-rich alpha-2-glycoprotein/LRG1, Fc-His; Leucine-rich alpha-2-glycoprotein; LRG and LRG1

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-hFc;C-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P02750

  • Expression Region

    V36-Q347

  • AA Sequence

    VTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    65-90 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LRG1 (Leucine-rich alpha-2-glycoprotein 1) is a glycoprotein that has gained significant attention in recent years due to its potential role in various biological processes and diseases. Initially identified as a protein associated with acute phase responses, LRG1 has been implicated in inflammatory conditions, cancer, and cardiovascular diseases. Its expression levels have been shown to correlate with disease severity, making it a candidate for diagnostic and prognostic biomarkers. Research indicates that LRG1 may play a role in angiogenesis, tissue repair, and the modulation of immune responses. As a result, the recombinant production of LRG1 has become a focal point for scientists seeking to further understand its functional roles and underlying mechanisms. By expressing LRG1 in suitable systems, researchers can study its biochemical properties, elucidate its interactions with other proteins, and investigate its impact on cellular pathways. Such studies are vital for determining LRG1's therapeutic potential and paving the way for new treatment strategies targeting its associated pathways. Understanding the properties and functions of LRG1 through recombinant technology may ultimately contribute to advancements in precision medicine and the development of novel diagnostic tools.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US