Analytical Data
-
Gene name
NTAQ1
-
简介
NTAQ1 Protein is a monomeric globular protein with alpha-beta-alpha three-layer sandwich architecture. NTAQ1 converts N-terminal glutamine to glutamate by eliminating the amine group and plays an essential role in the N-end rule pathway for protein degradation. The active site and catalytic mechanism of NTAQ1 are similar to those of transglutaminases. NTAQ1 Protein, Human (GST) is the recombinant human-derived NTAQ1 protein, expressed by E. coli , with N-GST labeled tag.
- Application
-
Alternative Names
Protein N-terminal glutamine amidohydrolase; WDYHV1; Protein NH2-terminal glutamine deamidase; N-terminal Gln amidase; Nt(Q)-amidase; C8orf32; NTAQ1
-
Species
Human
-
Source
E. coli
-
Tag
N-GST
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
AAH08781.1
-
Expression Region
M1-C205
-
AA Sequence
MEGNGPAAVHYQPASPPRDACVYSSCYCEENVWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQARPGDGPVIWDYHVVLLHVSSGGQSFIYDLDTVLPFPCLFDTYVEDAIKSDDDIHPQFRRKFRVICADSYLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGSKNC
-
Protein Length
Full Length
-
Molecular Weight
45-50 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NTAQ1, a recombinant protein derived from the nitrogenase enzyme complex found in certain nitrogen-fixing bacteria, has garnered significant attention in the fields of biochemistry and biotechnology due to its role in nitrogen metabolism. Nitrogen fixation is a critical biological process that converts atmospheric nitrogen into ammonia, which is essential for plant growth and agricultural productivity. The study of NTAQ1 is particularly intriguing because it may offer insights into the mechanisms of nitrogen assimilation and potential applications in sustainable agriculture, where reducing dependence on chemical fertilizers is a priority. Researchers aim to explore NTAQ1's structural and functional properties, which could lead to the development of novel biofertilizers or biocatalysts. Additionally, understanding NTAQ1 could enhance the efficiency of nitrogen fixation in transgenic plants, thereby improving crop yields while minimizing environmental impacts. Given the challenges posed by global food security and climate change, the investigation of NTAQ1 and its applications represents a promising avenue for advancing agricultural practices and contributing to a more sustainable future.
