Analytical Data
-
Gene name
Dermatopontin/DPT
-
简介
The dermapontin (DPT) protein mediates adhesion by binding to integrins on the cell surface and serves as a communication link between dermal fibroblasts and the extracellular matrix. It enhances TGFB1 activity, inhibits cell proliferation, accelerates collagen fiber formation, and stabilizes its resistance to low-temperature dissociation. Dermatopontin/DPT Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Dermatopontin/DPT protein, expressed by HEK293 , with C-hFc labeled tag.
- Application
-
Alternative Names
rMuDermatopontin, Fc; Early quiescence protein 1; EQ-1; Tyrosine-rich acidic matrix protein; TRAMP
-
Species
Mouse
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9QZZ6
-
Expression Region
Q19-V201
-
AA Sequence
QYGGYGYPYQQYQDYGDDGWVNLNRQGFSYQCPHGQVVVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQKCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWMTTEYPSHYGEDMDMISYDYDFYMRGATTTFSAVERDRQWKFIMCRMTDYDCEFENV
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
55 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Dermatopontin (DPT) is a small glycoprotein primarily found in the extracellular matrix, playing a crucial role in skin structure and function. Initially identified in dermal fibroblasts, DPT has garnered attention due to its involvement in various biological processes, including cell adhesion, migration, and proliferation. Its expression is particularly prominent in tissues subjected to mechanical stress, highlighting its potential role in wound healing and tissue repair. Research has indicated that DPT interacts with several extracellular matrix components, influencing collagen formation and organization, which is vital for maintaining skin integrity. Aberrant expression of DPT has been linked to several pathological conditions, such as fibrosis and skin diseases, suggesting its potential as a biomarker for disease progression. Additionally, studies have explored the therapeutic potential of recombinant DPT protein in regenerative medicine, given its ability to enhance cellular activities essential for tissue regeneration. As a result, the development of recombinant DPT and its applications in both basic research and clinical settings have become a focal point in dermatological studies, aiming to better understand its functional mechanisms and therapeutic potential in skin disorders and regenerative therapies.
