Cat: IPD-X24735

Recombinant Human HNRNPA1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HNRNPA1

  • 简介

    The HNRNPA1 protein is complexly involved in multiple RNA processing functions, packaging pre-mRNA into hnRNP particles, promoting Poly(A) mRNA transport, and regulating splice site selection. Crucially, it binds inhibitoryly to sequences flanking PKM exon 9, favoring the inclusion of exon 10 in pyruvate kinase PKM splicing, thereby generating the PKM M2 isoform. HNRNPA1 Protein, Human (His) is the recombinant human-derived HNRNPA1 protein, expressed by E. coli , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P09651-1

  • Expression Region

    S2-Q354

  • AA Sequence

    SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQ

  • Protein Length

    Partial

  • Molecular Weight

    40.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HNRNPA1 (heterogeneous nuclear ribonucleoprotein A1) is a multifunctional protein that plays a crucial role in the regulation of gene expression, RNA splicing, transport, and stability in eukaryotic cells. As a key component of the nuclear RNA-binding protein family, HNRNPA1 is involved in various cellular processes, including the formation of ribonucleoprotein complexes and the modulation of mRNA processing. Research has increasingly focused on HNRNPA1 due to its implications in various diseases, particularly neurodegenerative disorders, where its aggregation has been linked to cellular dysfunction. Additionally, its role in stress granule formation highlights its importance in cellular responses to stress. The study of recombinant HNRNPA1 protein provides a valuable platform for elucidating its structural and functional properties, as well as the molecular mechanisms underlying its involvement in RNA metabolism and disease. Understanding the biophysical characteristics and interactions of HNRNPA1 through recombinant technologies can facilitate the development of targeted therapies and diagnostic tools, making it a significant focus within molecular biology and biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US