Cat: IPD-X24679

Recombinant Human Fetuin A/AHSG Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Fetuin A/AHSG

  • 简介

    Fetuin A (or AHSG protein) plays multiple roles in cellular processes, promotes endocytosis and displays opsonic properties. It regulates the mineral phase of bone, affects bone homeostasis, and has significant affinity for calcium and barium ions. Fetuin A/AHSG Protein, Human (HEK293, His) is the recombinant human-derived Fetuin A/AHSG protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuAlpha-2-HS-glycoprotein/AHSG, His; Alpha-2-HS-Glycoprotein; Alpha-2-Z-Globulin; Ba-Alpha-2-Glycoprotein; Fetuin-A; AHSG; FETUA

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    AAH48198.1

  • Expression Region

    A19-V367

  • AA Sequence

    APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV

  • Protein Length

    Partial

  • Molecular Weight

    60.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Fetuin A, also known as alpha-₂-HS-glycoprotein (AHSG), is a glycoprotein predominantly produced by the liver and plays a critical role in several biological processes, including mineral metabolism, insulin signaling, and regulation of inflammation. Recent research has highlighted its potential implications in various diseases, including cardiovascular disorders, diabetes, and obesity. The interest in recombinant Fetuin A arises from the need for understanding its biological functions in detail and exploring its therapeutic potential. By producing recombinant forms of this protein, scientists aim to investigate its mechanisms of action, elucidate its interactions with cellular receptors, and evaluate its effects on metabolic pathways. Furthermore, the development of recombinant Fetuin A could serve as a valuable tool for drug discovery and the development of therapeutic strategies aimed at mitigating diseases related to its dysregulation. Consequently, the production and characterization of recombinant Fetuin A/AHSG have become a significant focus in biomedical research, paving the way for potential applications in clinical settings and enhancing our understanding of its role in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US