Analytical Data
-
Gene name
VSIG8
- Application
-
Alternative Names
V-set and immunoglobulin domain-containing protein 8; Vsig8
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6P3A4-1
-
Expression Region
V22-G262
-
AA Sequence
VRINGDGQEVMYLAEGDNVRLGCPYLLDPEDLGTNSLDIEWMQVNSEPSHRENVFLTYQDKRIGHGNLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIVTVQARPAVPMCWTEGHMSKGNDVVLKCFANGGSQPLSYKWAKISGHSHPYRAGAYHSQHSFHSELSYQESFHSTINQGLGNGDLLLKGINADDDGLYQCTVANHVGYSVCVVEVKVSDSQRVG
-
Protein Length
Extracellular Domain
-
Molecular Weight
28.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VSIG8 (V-set and immunoglobulin domain-containing protein 8) is a member of the immunoglobulin superfamily, playing a pivotal role in immune regulation and signaling. Recent studies have highlighted its significant involvement in various biological processes, including T cell activation, immune response modulation, and potential tumor immunology. VSIG8 is expressed in certain immune cells, suggesting its role as a co-stimulatory or inhibitory receptor. The understanding of VSIG8's structure and function is important for elucidating its mechanisms in immune responses, particularly in the context of autoimmune diseases, infections, and cancer. The exploration of VSIG8 as a therapeutic target has gained momentum, given its potential for developing novel immunotherapies. Consequently, researchers are increasingly focusing on the recombinant expression of VSIG8 to study its interactions, signaling pathways, and the effects of its ligands. This research could pave the way for targeted therapies that modulate immune responses, highlighting the importance of VSIG8 in both basic immunology and clinical applications.
