Cat: IPD-X24566

Recombinant Mouse HNRNPA2B1 Protein,His & SUMO

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HNRNPA2B1

  • 简介

    The HNRNPA2B1 protein is an important heterogeneous nuclear ribonucleoprotein (hnRNP) that plays a key role in RNA processing and transport. It forms hnRNP particles that compact and stabilize transcripts to influence various cellular functions, including transcription, mRNA processing, nuclear export, localization, translation, and mRNA stability. HNRNPA2B1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived HNRNPA2B1 protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Hnrnpa2b1; Hnrpa2b1; Heterogeneous nuclear ribonucleoproteins A2/B1; hnRNP A2/B1

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    N-10*His;N-SUMO;C-Myc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O88569

  • Expression Region

    M1-Y353

  • AA Sequence

    MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGSYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY

  • Protein Length

    Full Length

  • Molecular Weight

    57.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1) is a crucial RNA-binding protein involved in various cellular processes, including pre-mRNA splicing, transport, and stability. This protein plays a significant role in the regulation of gene expression, influencing alternative splicing and mRNA stability in response to cellular signals. Dysregulation of HNRNPA2B1 has been implicated in several diseases, including cancers and neurodegenerative disorders, indicating its potential as a therapeutic target. Researchers study recombinant HNRNPA2B1 to elucidate its functional mechanisms and interactions with RNA and other cellular components. The production of this protein in a recombinant form allows for detailed structural and functional analyses, facilitating the investigation of its role in post-transcriptional regulation. Moreover, by understanding how HNRNPA2B1 modulates RNA dynamics, researchers hope to uncover novel pathways involved in disease pathology and identify new biomarkers or therapeutic strategies. The study of recombinantly expressed HNRNPA2B1 is essential for bridging the gap between basic research and clinical applications, offering insights into the complex interplay between RNA-binding proteins and their target RNAs in the context of cellular homeostasis and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US