Cat: IPD-X24530

Recombinant Human Stratifin Protein

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Stratifin

  • 简介

    Stratifin (14-3-3 sigma), encoded by SFN, functions as a multifaceted adapter protein that binds to partners through phosphoserine or phosphothreonine motifs and participates in a variety of cellular processes. It regulates epithelial cell growth and protein synthesis through keratin 17 (KRT17), and may affect MDM2 autoubiquitination and activate p53. Stratifin Protein, Human is the recombinant mouse-derived Stratifin protein, expressed by E. coli , with tag free.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    14-3-3 Protein Sigma; Epithelial Cell Marker Protein 1; Stratifin; SFN; HME1

  • Species

    Human

  • Source

    E. coli

  • Tag

    Tag Free

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P31947-1

  • Expression Region

    M1-S248

  • AA Sequence

    MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS

  • Protein Length

    Full Length of Isoform-1

  • Molecular Weight

    30.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Stratifin, also known as SFN or 14-3-3 sigma, is a member of the 14-3-3 protein family that plays a crucial role in various cellular processes, including cell cycle regulation, apoptosis, and stress response. Research on Stratifin has gained prominence due to its significant implications in cancer biology and its potential as a biomarker for various malignancies. In normal tissues, Stratifin is involved in the regulation of cell proliferation and differentiation, acting as a tumor suppressor. However, its expression is often downregulated or lost in several types of tumors, contributing to uncontrolled cell growth and tumor progression. Understanding the mechanisms governing Stratifin's function and its interactions with other molecular pathways is essential for elucidating its role in tumorigenesis. Recent studies have focused on the recombinant production of Stratifin to investigate its structural and functional properties, providing insights into its biological activity. These recombinant proteins enable detailed studies of Stratifin's interactions with other cellular proteins, offering potential avenues for therapeutic intervention in cancer treatment. The exploration of Stratifin's role in cellular signaling and its potential use as a therapeutic target highlights the need for continued research in this area, which could pave the way for novel approaches in cancer diagnostics and treatment strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US