Analytical Data
-
Gene name
MSTN
-
简介
MSTN (Myostatin) serves as a dedicated negative regulator of skeletal muscle growth, forming homodimers through disulfide linkages. It inhibits WFIKKN2 activity through interaction and further contributes to its role in negatively modulating skeletal muscle growth by engaging with FSTL3. MSTN Protein, Cat (HEK293, His) is the recombinant cat-derived MSTN protein, expressed by HEK293 , with N-10*His labeled tag.
- Application
-
Alternative Names
myostatin; GDF8; MSLHP; growth/differentiation factor 8; GDF-8; growth differentiation factor 8
-
Species
Cat
-
Source
HEK293
-
Tag
N-10*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
M3WPT7
-
Expression Region
G19-S375
-
AA Sequence
GPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDAIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDLLMQVEGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
45-50 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Myostatin (MSTN), a member of the transforming growth factor-beta (TGF-β) superfamily, plays a crucial role in the regulation of skeletal muscle growth and development. Originally identified as a negative regulator of muscle mass, MSTN inhibits muscle differentiation and proliferation, thus maintaining muscle homeostasis. Research has shown that mutations or disruptions in the MSTN gene lead to significant muscle hypertrophy in various animal models, including cattle, sheep, and mice, sparking considerable interest in its potential applications in agricultural and therapeutic contexts. Recombinant MSTN proteins have been generated to better understand the molecular mechanisms underlying muscle growth and to explore strategies for muscle-wasting conditions in humans. These proteins serve as valuable tools for studying the signaling pathways involved in muscle development, and they are also being investigated for their potential to enhance muscle regeneration following injury. As the understanding of MSTN's biological functions expands, so does the promise of utilizing MSTN modulation in clinical settings, such as in combating age-related muscle loss and muscular dystrophies. The production and characterization of recombinant MSTN proteins have thus become a focal point of research, aiming to leverage their biological properties for both fundamental insights and therapeutic advancements.











