Cat: IPD-X37095

Recombinant Human HEMK2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HEMK2

  • 简介

    Contrary to the expected interaction, HEMK2 protein did not bind to TRMT112. This unique feature distinguishes HEMK2 from expected protein-protein interactions typically associated with its functional counterparts. HEMK2 Protein, Human (His) is the recombinant human-derived HEMK2 protein, expressed by E. coli , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Methyltransferase N6AMT1; Lysine N-methyltransferase 9; N6AMT1; C21orf127; HEMK2; KMT9; PRED28

  • Species

    Human

  • Source

    E. coli

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y5N5-2

  • Expression Region

    M1-S186

  • AA Sequence

    MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS

  • Protein Length

    Full Length of Isoform-2

  • Molecular Weight

    23 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HEMK2, or Hematopoietic-specific protein 2, is a member of the Hematopoietic and endothelial-specific protein family, playing a crucial role in hematopoiesis and endothelial functions. Research into HEMK2 recombinant proteins has gained momentum due to its potential implications in understanding blood cell development and vascular biology. The study of this protein is particularly significant as it may provide insights into various hematological disorders and cardiovascular diseases. Recombinant expression techniques allow for the production of HEMK2 in controlled laboratory settings, facilitating detailed investigations into its structure, function, and interactions with other molecular pathways. Advances in this area could lead to the identification of novel therapeutic targets and biomolecular markers for diseases associated with abnormal hematopoietic and endothelial function. Additionally, HEMK2's involvement in cellular signaling processes positions it as a critical player in the development of targeted treatments aimed at modulating these pathways. Overall, the exploration of HEMK2 recombinant protein not only enhances our fundamental understanding of its biological roles but also holds promise for innovative approaches in clinical research and therapeutic development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US