Analytical Data
-
Gene name
CTRB1
- Application
-
Alternative Names
Chymotrypsinogen B; CTRB1; CTRB
-
Species
Rat
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P07338
-
Expression Region
C19-N263
-
AA Sequence
CGVPTIQPVLTGLSRIVNGEDAIPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVKTSDVVVAGEFDQGSDEENIQVLKIAQVFKNPKFNMFTVRNDITLLKLATPAQFSETVSAVCLPNVDDDFPPGTVCATTGWGKTKYNALKTPEKLQQAALPIVSEADCKKSWGSKITDVMTCAGASGVSSCMGDSGGPLVCQKDGVWTLAGIVSWGSGVCSTSTPAVYSRVTALMPWVQQILEAN
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CTRB1, or Chymotrypsinogen B1, is a serine protease involved in various physiological processes, including protein digestion and immune response regulation. Research on CTRB1 recombinant protein has gained traction due to its potential therapeutic implications, particularly in treating pancreatic disorders and other conditions linked to protein metabolism. The ability to produce CTRB1 as a recombinant protein facilitates detailed studies on its structure and functionality, allowing for the exploration of its enzymatic mechanisms and interactions with substrates and inhibitors. Moreover, recombinantly produced CTRB1 can be utilized in biochemical assays and drug development, providing insights into how modulating its activity could influence disease outcomes. Given its role in health and disease, understanding CTRB1’s structure-function relationship through recombinant technology is crucial for harnessing its therapeutic potential and elucidating its biological significance. As studies continue to uncover the nuances of CTRB1, it holds promise not only as a target for drug design but also as a biomarker for assessing pancreatic health and disease.











