Cat: IPD-X37067

Recombinant Human GFPT1 Protein

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GFPT1

  • 简介

    As a key regulator of glucose influx into the hexosamine pathway, the GFPT1 protein plays a key role in controlling the availability of protein N- and O-linked glycosylation precursors. In addition, GFPT1 is involved in the regulation of circadian expression of clock genes BMAL1 and CRY1 and contributes to the complex regulation of cytoplasmic UDP-GlcNAc metabolic fluctuations. GFPT1 Protein, Human is the recombinant human-derived GFPT1 protein, expressed by E. coli , with tag free.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; GFAT1; GFAT; GFPT

  • Species

    Human

  • Source

    E. coli

  • Tag

    Tag Free

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    Q06210-1

  • Expression Region

    Q332-E699

  • AA Sequence

    QQIMKGNFSSFMQKEIFEQPESVVNTMRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFLSQSGETADTLMGLRYCKERGALTVGITNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKEVLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPHSVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE

  • Protein Length

    Partial

  • Molecular Weight

    41.5 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GFPT1 (Glutamine-Fructose-6-Phosphate Transaminase 1) is an important enzyme in the hexosamine biosynthetic pathway, which plays a crucial role in cellular metabolism and signaling. It catalyzes the conversion of fructose-6-phosphate and glutamine to glucosamine-6-phosphate, a precursor for various glycosylation processes. Aberrant GFPT1 activity has been linked to several metabolic disorders, including obesity, diabetes, and cancer. Research has highlighted its potential as a biomarker for these conditions, as well as its involvement in the modulation of insulin signaling and inflammation. In addition, GFPT1 has garnered attention for its role in the development of complications related to diabetes, such as neuropathy and retinopathy, by influencing the production of advanced glycation end-products (AGEs). Understanding the molecular mechanisms underlying GFPT1's function and regulation is essential for the development of targeted therapies aimed at metabolic diseases. Moreover, the production of recombinant GFPT1 protein has become a focal point for studying its biochemical properties and interactions within the cell, providing insights into its therapeutic potential and paving the way for novel interventions in metabolic dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US