Analytical Data
-
Gene name
GALNT2
-
简介
The GALNT2 protein catalyzes the initial steps in O-linked oligosaccharide biosynthesis by transferring N-acetyl-D-galactosamine to a protein receptor. GALNT2 Protein, Human (HEK293, His) is the recombinant human-derived GALNT2 protein, expressed by HEK293 , with N-His labeled tag.
- Application
-
Alternative Names
Polypeptide N-acetylgalactosaminyltransferase 2; GalNAc-T2
-
Species
Human
-
Source
HEK293
-
Tag
N-10*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q10471-1
-
Expression Region
K52-Q571
-
AA Sequence
KKKDLHHSNGEEKAQSMETLPPGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLNLQQ
-
Protein Length
Full Length of GALNT2 soluble form
-
Molecular Weight
63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GALNT2, or UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2, is an enzyme that plays a significant role in the glycosylation process, specifically in the addition of GalNAc to serine or threonine residues on target proteins. This post-translational modification is crucial for various biological processes, including protein stability, cell signaling, and receptor interactions. Recent studies have highlighted the importance of GALNT2 in health and disease, particularly its involvement in metabolic disorders and cancer progression. Abnormal GALNT2 activity has been linked to altered glycosylation patterns, which can affect tumorigenesis and cellular communication. Consequently, the recombinant production of GALNT2 has become a focal point for research. By creating a functional GALNT2 protein through recombinant DNA technology, researchers aim to investigate its enzymatic activity, substrate specificity, and biological implications. This research not only enhances our understanding of GALNT2’s role in glycosylation but also opens avenues for therapeutic strategies targeting glycosylation-related diseases. A deeper insight into GALNT2 function could potentially lead to novel diagnostic markers or treatments for conditions where glycosylation is disrupted, making it a valuable subject of ongoing scientific inquiry.
