Cat: IPD-X37042

Recombinant Human METTL1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    METTL1

  • 简介

    The METTL1 protein is a catalytic component of the METTL1-WDR4 methyltransferase complex, which promotes the formation of N(7)-methylguanine in tRNA, mRNA, and miRNA. METTL1 Protein, Human (His) is the recombinant human-derived METTL1 protein, expressed by E. coli , with N-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured in a cell proliferation assay using HepG2 cells. The ED50 for this effect is 0.9259 ng/mL, corresponding to a specific activity is 1.080×106 units/mg. Measured in a cell proliferation assay using HepG2 cells. The ED50 for this effect is 0.9259 ng/mL , corresponding to a specific activity is 1.080×106 units/mg.

  • Alternative Names

    tRNA (guanine-N(7)-)-methyltransferase; Methyltransferase-like protein 1; METTL1; C12orf1

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    Q9UBP6-1

  • Expression Region

    D32-Q265

  • AA Sequence

    DHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQ

  • Protein Length

    Partial

  • Molecular Weight

    30 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

METTL1, or Methyltransferase-like 1, is a member of the methyltransferase family and plays a crucial role in the methylation of adenosine residues in RNA, particularly in transfer RNA (tRNA). This methylation is essential for the stability and translation efficiency of tRNAs, affecting protein synthesis and, consequently, various cellular processes. Recent studies have suggested that METTL1 is involved in several biological functions, including cellular stress responses, differentiation, and various diseases, such as cancer. Given its pivotal role in RNA metabolism, the reconstitution of METTL1 as a recombinant protein offers a valuable approach to study its enzymatic activity, substrate specificity, and regulatory mechanisms. The recombinant METTL1 can be utilized in in vitro assays to elucidate the dynamics of RNA methylation, paving the way for therapeutic strategies targeting dysregulated methylation pathways. Understanding METTL1 function and its interactions with substrates and other cellular factors can provide insights into the broader implications of RNA modification in health and disease. Thus, the research surrounding METTL1 not only enhances our knowledge of fundamental biological processes but also opens avenues for novel disease interventions, making it a compelling focus for ongoing scientific investigation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US