Cat: IPD-X37041

Recombinant Human HNMT Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HNMT

  • 简介

    The HNMT protein plays a pivotal role in histamine metabolism, facilitating its inactivation through N-methylation. This enzymatic activity is crucial for histamine degradation, emphasizing HNMT's essential function in modulating histamine levels. Its involvement in regulating the airway response to histamine underscores its significance in maintaining physiological homeostasis, potentially impacting immune and inflammatory responses. HNMT Protein, Human (His) is the recombinant human-derived HNMT protein, expressed by E. coli , with N-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Histamine N-methyltransferase; HMT; HNMT

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    AAH20677.1

  • Expression Region

    M1-A292

  • AA Sequence

    MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA

  • Protein Length

    Full Length

  • Molecular Weight

    32 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Human neutral core histone methyltransferase (HNMT) is an essential enzyme that plays a critical role in the regulation of gene expression through histone modification, specifically by catalyzing the methylation of lysine residues on histones. This post-translational modification is pivotal for chromatin structure and function, influencing processes such as DNA repair, replication, and transcriptional regulation. Dysregulation of histone methyltransferases like HNMT has been linked to various diseases, including cancer, where aberrant methylation patterns can lead to the inappropriate activation or silencing of genes. Given the importance of HNMT in epigenetic regulation, researchers are increasingly focused on developing recombinant proteins for functional studies and therapeutic applications. Understanding HNMT's specific mechanisms of action and its potential as a drug target could pave the way for novel epigenetic therapies. The recombinant expression of HNMT allows for detailed biochemical characterization, providing insights into its substrate specificity, enzyme kinetics, and interaction with other cellular factors. Investigating HNMT not only enhances our understanding of chromatin remodeling but also contributes to the broader field of epigenetics, making it a vital area of study in both basic and applied biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US