Cat: IPD-X32267

Recombinant Human Caspase-10/CASP10 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Caspase-10/CASP10

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuCaspase-10, His; Caspase-10; CASP-10; Apoptotic Protease Mch-4; ICE-Like Apoptotic Protease 4; CASP10; MCH4

  • Species

    Human

  • Source

    E. coli

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q92851-4

  • Expression Region

    V220-R472

  • AA Sequence

    VKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRHEDILSIHHHHHH

  • Protein Length

    Partial

  • Molecular Weight

    33 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Caspase-10, encoded by the CASP10 gene, is a crucial member of the cysteine-aspartic protease (caspase) family, which plays a pivotal role in the apoptosis (programmed cell death) pathway. This protein is primarily known for its role in mediating extrinsic apoptosis through the tumor necrosis factor (TNF) receptor signaling pathway and is involved in the regulation of immune responses. Mutations or dysregulation of CASP10 have been associated with various diseases, including certain cancers and autoimmune disorders. The study of recombinant Caspase-10 protein has gained significance in recent years as it provides insights into the mechanisms of cell death and survival, cell signaling pathways, and potential therapeutic applications. By producing and characterizing recombinant Caspase-10, researchers can better understand its functional role in apoptotic processes, explore its interactions with other proteins, and investigate its implications in disease mechanisms. This substrate is essential for studying caspase activation, understanding the apoptotic cascade, and developing targeted therapies that leverage apoptosis modulation. Thus, recombinant Caspase-10 serves as a valuable tool in both basic research and the development of novel therapeutic strategies in oncology and immunology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US