Analytical Data
-
Gene name
ADPRH/ARH1
- Application
-
Alternative Names
rHuADP-ribosylarginine hydrolase, His; ADPRH; ARH-1; ADP-ribosylarginine hydrolase
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P54922
-
Expression Region
M1-L357
-
AA Sequence
HHHHHHMEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAPGGASVHNAMQLKPGKPNGWRIPFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTAYAVNSRPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGESAPTFPESFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL
-
Protein Length
Full Length
-
Molecular Weight
39 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ADPRH, also known as ARH1, is a gene that encodes a protein involved in the regulation of various cellular processes, including the response to DNA damage and cellular stress. This protein plays a crucial role in the synthesis of ADP-ribose, a signaling molecule that modifies proteins and affects their function, thereby influencing cellular activities such as apoptosis, DNA repair, and gene expression. Dysregulation of ADPRH/ARH1 has been linked to several diseases, including cancer, where altered ADP-ribosylation patterns can contribute to tumorigenesis and disease progression. Research into ADPRH/ARH1 recombinant proteins has gained attention as scientists aim to better understand its biological functions and mechanisms in health and disease. By studying these recombinant proteins, researchers hope to elucidate the pathways that involve ADP-ribosylation and its effects on cellular signaling. Additionally, characterizing ADPRH/ARH1 recombinant proteins could pave the way for the development of novel therapeutic approaches, leveraging its role in modulating cellular responses. This line of research is particularly relevant given the therapeutic potential in targeting cancer cells with alterations in their ADP-ribosylation pathways, highlighting the importance of understanding ADPRH/ARH1 in both basic biology and clinical applications.
