Analytical Data
-
Gene name
SULT4A1
-
简介
SULT4A1 Protein, an atypical sulfotransferase, shows low PAPS affinity and minimal catalytic activity toward substrates like L-triiodothyronine and estrone.Despite limited efficiency, SULT4A1 may impact drug and neurotransmitter metabolism in the central nervous system (CNS).SULT4A1 Protein, Human is the recombinant human-derived SULT4A1 protein, expressed by E.coli , with tag free.
- Application
-
Alternative Names
Sulfotransferase 4A1; ST4A1; Brain Sulfotransferase-Like Protein; hBR-STL; hBR-STL-1; Nervous System Sulfotransferase; NST; SULT4A1; SULTX3
-
Species
Human
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BR01
-
Expression Region
M1-L284
-
AA Sequence
MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL
-
Protein Length
Full Length
-
Molecular Weight
34.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SULT4A1, or sulfotransferase family 4 member A1, is an important enzyme involved in the sulfation process, which is a critical phase II metabolism pathway that conjugates various endogenous and exogenous compounds with sulfate groups. This enzyme is unique among sulfotransferases due to its distinct substrate specificity, particularly in the metabolism of neuroactive compounds, hormones, and drugs. Research has indicated that SULT4A1 plays a significant role in drug disposition and neurotoxicity, making it a focus of interest in pharmacology and toxicology. Furthermore, its distinct expression patterns in different tissues, particularly in the brain, suggest that it may have important physiological and pathological functions, including potential implications in neurodegenerative diseases and psychiatric disorders. Despite its significance, the structural and functional properties of SULT4A1 remain underexplored, prompting investigations into the recombinant expression of the protein. This research aims to facilitate a better understanding of its enzymatic mechanisms, substrate interactions, and regulatory pathways, thereby contributing to the development of therapeutic strategies targeting SULT4A1-related disorders and enhancing drug efficacy and safety. The recombinant production of SULT4A1 is crucial for crystallization studies, enzyme kinetics, and drug interaction assays, positioning it as a vital step in comprehensively understanding its biological roles and potential as a biomarker or therapeutic target.
