Cat: IPD-X36846

Recombinant Human GAMT Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    GAMT

  • 简介

    GAMT protein uses S-adenosylmethionine as a methyl donor to catalyze the conversion of guanidinoacetic acid into creatine, playing a key role in cell metabolism. This enzyme activity is essential for the biosynthesis of creatine, a compound necessary for cellular energy storage and transport. GAMT Protein, Human (His) is the recombinant human-derived GAMT protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuGuanidinoacetate N-methyltransferase/GAMT, His; Guanidinoacetate N-methyltransferase; GAMT; PIG2; TP53I2

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6*His;C-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    Q14353-1

  • Expression Region

    M1-G236

  • AA Sequence

    MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG

  • Protein Length

    Full Length of Isoform-1

  • Molecular Weight

    27-32 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

GAMT (guanidinoacetate N-methyltransferase) is an important enzyme involved in the biosynthesis of creatine, which plays a crucial role in energy metabolism within muscle and brain tissues. Research into GAMT has garnered attention due to its connection to various metabolic disorders, particularly GAMT deficiency, a rare genetic condition that leads to elevated levels of guanidinoacetate and subsequently causes neurological impairment. Understanding the structure and function of GAMT through recombinant protein studies is vital for elucidating its role in cellular metabolism and the pathogenesis of related disorders. Recombinant GAMT proteins, produced through techniques such as bacterial expression systems, can be instrumental for investigating the enzyme’s kinetic properties, substrate specificity, and regulatory mechanisms. Furthermore, insights gained from such studies can pave the way for potential therapeutic interventions, including enzyme replacement strategies or small molecule modulators. The ongoing research into GAMT recombinant proteins not only enhances our fundamental understanding of this enzyme but also holds promise for addressing the clinical challenges faced by individuals with GAMT deficiency and similar metabolic conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US