Cat: IPD-X32127

Recombinant Mouse Tissue alpha-L-Fucosidase Protein,His & SUMO

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Tissue alpha-L-Fucosidase

  • 简介

    Tissue alpha-L-Fucosidase Proteinas, an enzymatic entity, crucially hydrolyzes alpha-1,6-linked fucose residues on glycoproteins' carbohydrate moieties. Tissue alpha-L-Fucosidase Protein, Mouse (His-SUMO) is the recombinant mouse-derived Tissue alpha-L-Fucosidase protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Fuca1; FucaTissue alpha-L-fucosidase; EC 3.2.1.51; Alpha-L-fucosidase I; Alpha-L-fucoside fucohydrolase 1; Alpha-L-fucosidase 1

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    N-His;N-SUMO

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q99LJ1

  • Expression Region

    L18-N452

  • AA Sequence

    LAPRRFTPDWQSLDSRPLPSWFDEAKFGVFVHWGVFSVPAWGSEWFWWHWQGDRMPAYQRFMTENYPPGFSYADFAPQFTARFFHPDQWAELFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGAAVRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVRAKTMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTSFLAWLYNDSPVKDEVIVNDRWGQNCSCHHGGYYNCQDKYKPQSLPDHKWEMCTSMDRASWGYRKDMTMSTIAKENEIIEELVQTVSLGGNYLLNIGPTKDGLIVPIFQERLLAVGKWLQINGEAIYASKPWRVQSEKNKTVVWYTTKNATVYATFLYWPENGIVNLKSPKTTSATKITMLGLEGDLSWTQDPLEGVLISLPQLPPTVLPVEFAWTLKLTKVN

  • Protein Length

    Full Length of Mature Protein

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Tissue alpha-L-fucosidase is an important enzyme involved in glycoprotein degradation and is essential for various biological processes, including cellular communication and immune response. Deficiency in this enzyme is associated with genetic disorders, such as fucosidosis, which leads to the accumulation of fucosylated compounds and results in severe clinical manifestations. Research into the recombinant expression of tissue alpha-L-fucosidase is crucial for understanding its structure, function, and potential therapeutic applications. By producing this enzyme in a recombinant system, researchers aim to obtain sufficient quantities for enzymatic characterization, elucidate its catalytic mechanisms, and explore its role in disease pathology. Additionally, recombinant alpha-L-fucosidase could pave the way for developing enzyme replacement therapies for patients with fucosidosis and other related disorders. Advances in recombinant DNA technology have facilitated the expression of this enzyme in various host systems, enabling optimized production processes and functional studies. Thus, the exploration of recombinant tissue alpha-L-fucosidase not only contributes to the fundamental biochemistry of glycan metabolism but also holds promise for clinical advancements in treating disorders linked to fucose metabolism.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US