Analytical Data
-
Gene name
RecO
-
简介
RecO protein, a crucial participant in DNA repair and the RecF pathway, operates as a monomer, contributing to the intricate choreography of DNA repair mechanisms and facilitating recombination. Its monomeric form underscores its singular involvement, highlighting its significance in orchestrating cellular responses to DNA damage and recombination. RecO Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RecO protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
- Application
-
Alternative Names
recO; b2565; JW2549; DNA repair protein RecO; Recombination protein O
-
Species
E.coli
-
Source
E. coli
-
Tag
N-SUMO;N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0A7H3
-
Expression Region
M1-E242
-
AA Sequence
MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFMPKRTVKTHYE
-
Protein Length
Full Length
-
Molecular Weight
43.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RecO proteins are essential components of the DNA repair and recombination machinery in bacteria. They play a critical role in promoting homologous recombination, a process that is crucial for maintaining genomic integrity, especially under conditions of DNA damage. The study of RecO proteins has gained significant attention due to their involvement in repairing double-strand breaks and facilitating the exchange of genetic material, which is vital for bacterial evolution and adaptation. Understanding the mechanisms by which RecO proteins function can provide insights into bacterial survival strategies, particularly in hostile environments, and may reveal potential targets for novel antimicrobial therapies. Furthermore, the study of RecO and its interactions with other recombination proteins, such as RecA, highlights the complexity and efficiency of bacterial DNA repair systems. Insights gained from RecO research not only contribute to our fundamental understanding of microbial genetics but also have broader implications in biotechnology and medicine, where knowledge of DNA repair mechanisms can inform the development of genetic engineering techniques and therapies for genetic disorders. Thus, the exploration of RecO proteins represents a significant area of molecular biology research with implications that extend beyond basic science into the fields of health and disease management.
