Analytical Data
-
Gene name
PLBD2
-
简介
PLBD2 Protein, a putative phospholipase, interacts with insulin-like growth factor 2 receptor (IGF2R), suggesting involvement in growth and signaling pathways. Despite unknown details about its phospholipase activity, PLBD2's exploration may unveil insights into its role in cellular homeostasis and regulatory mechanisms. PLBD2 Protein, Mouse (His) is the recombinant mouse-derived PLBD2 protein, expressed by E. coli , with N-His labeled tag.
- Application
-
Alternative Names
Plbd2; Putative phospholipase B-like 2; EC 3.1.1.-; 66.3kDa protein; 76kDa protein; p76; LAMA-like protein 2; Lamina ancestor homolog 2
-
Species
Mouse
-
Source
E. coli
-
Tag
N-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q3TCN2-1
-
Expression Region
L47-D594
-
AA Sequence
LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPWD
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PLBD2 (phospholipase B domain-containing protein 2) has emerged as a protein of interest due to its potential roles in lipid metabolism and cellular signaling. This protein is primarily expressed in various tissues, suggesting its involvement in diverse biological processes. Research indicates that PLBD2 might contribute to membrane lipid remodeling and thus influence cell membrane properties, impacting cellular functions such as growth, differentiation, and apoptosis. Given its enzymatic activity related to phospholipid hydrolysis, PLBD2 has been implicated in the pathogenesis of several diseases, including inflammatory disorders and metabolic syndromes. Despite its potential significance, the detailed mechanisms through which PLBD2 operates remain poorly understood, necessitating further investigation. Recombinant PLBD2 protein studies provide a valuable tool for elucidating its structural and functional characteristics, enabling researchers to explore its enzymatic properties, substrate specificity, and regulatory mechanisms. Such studies could open novel therapeutic avenues targeting PLBD2-related pathways, making it a focal point for future research in both basic biology and clinical applications. Overall, by advancing our understanding of PLBD2, we aim to clarify its biological significance and therapeutic potential in various health conditions.
