Analytical Data
-
Gene name
DDX39B
-
简介
The DDX39B protein intricately coordinates nuclear mRNA export and is specifically associated with spliced mRNA as a key component of the TREX complex. This coupling of mRNA transcription, processing, and export involves rounds of ATP-dependent hydrolysis, recruiting components such as ALYREF/THOC and CHTOP. DDX39B Protein, Human (GST) is the recombinant human-derived DDX39B protein, expressed by E. coli , with N-GST labeled tag.
- Application
-
Species
Human
-
Source
E. coli
-
Tag
N-GST
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13838
-
Expression Region
A2-V251
-
AA Sequence
AENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFV
-
Protein Length
Partial
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DDX39B, a member of the DEAD-box RNA helicase family, plays a pivotal role in various RNA processing events, including splicing, transport, and translation. Its critical involvement in these cellular processes makes it a significant focus of research, particularly in the context of cancer and other diseases. Dysregulation of RNA helicases like DDX39B has been linked to oncogenic processes, thereby implicating its potential as a therapeutic target. Recent studies have highlighted DDX39B's impact on the regulation of gene expression and its interaction with RNA-binding proteins, which are key players in the maintenance of cellular homeostasis. Moreover, the understanding of DDX39B's structure-function relationship has advanced through recombinant protein studies, facilitating insights into its mechanistic roles and regulatory networks. This groundwork lays the foundation for further exploration of DDX39B in disease pathways, with the hope that elucidating its function will lead to novel interventions in cancer treatment and other related disorders.
