Analytical Data
-
Gene name
HGFA/HGF Activator
-
简介
HGFA/HGF activating proteins activate HGF by converting HGF into its heterodimeric form, which is critical for cell growth, development, and tissue repair. It induces cellular responses such as proliferation, migration, and differentiation. HGFA/HGF Activator Protein, Mouse (HEK293, His) is the recombinant mouse-derived HGFA/HGF Activator protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Biological Activity
Measured in a cell proliferation assay using hepG2 human hepatocellular carcinoma cells. The ED50 for this effect is 0.951 μg/mL, corresponding to a specific activity is 5.126×103 U/mg. Measured in a cell proliferation assay using hepG2 human hepatocellular carcinoma cells. The ED50 for this effect is 0.951 μg/mL, corresponding to a specific activity is 5.126×103 U/mg.
-
Alternative Names
HGF activator; HGFA; Hgfac; MGC138395; MGC138397
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q9R098
-
Expression Region
Q35-S653
-
AA Sequence
QAGRNHTEPPGPNVTATPVTPTIPVISGNVSTSTESAPAAETEGPQSERYPPPSSSSPPGGQVLTESGQPCRFPFRYGGRMLHSCTSEGSAYRKWCATTHNYDRDRAWGYCAEVTLPVEGPAILDPCASGPCLNGGTCSSTHDHGSYHCSCPLAFTGKDCGTEKCFDETRYEYFEVGDHWARVSEGHVEQCGCMEGQARCEDTHHTACLSSPCLNGGTCHLIVGTGTSVCTCPLGYAGRFCNIVPTEHCFLGNGTEYRGVASTAASGLSCLAWNSDLLYQELHVDSVAAAVLLGLGPHAYCRNPDKDERPWCYVVKDNALSWEYCRLTACESLARVHSQTPEILAALPESAPAVRPTCGKRHKKRTFLRPRIIGGSSSLPGSHPWLAAIYIGNSFCAGSLVHTCWVVSAAHCFANSPPRDSITVVLGQHFFNRTTDVTQTFGIEKYVPYTLYSVFNPNNHDLVLIRLKKKGERCAVRSQFVQPICLPEAGSSFPTGHKCQIAGWGHMDENVSSYSNSLLEALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLVCEKNGVAYLYGIISWGDGCGRLNKPGVYTRVANYVDWINDRIRPPKRPVATS
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
107.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HGF (Hepatocyte Growth Factor) and its activator, HGFA (HGF Activator), play crucial roles in various biological processes, including cell growth, survival, and tissue regeneration. HGFA is a serine protease that converts the inactive form of HGF into its active state, thus facilitating its function in cellular signaling pathways. Recent studies have highlighted the significance of HGF and HGFA in various physiological and pathological conditions, such as wound healing, cancer metastasis, and liver diseases. Due to their pivotal roles, the recombinant proteins of HGFA and HGF have gained attention as potential therapeutic agents. Researchers are focusing on their mechanisms of action, structural properties, and interactions with specific receptors to harness their therapeutic potential. By understanding these proteins at a molecular level, scientists aim to develop innovative treatments that can effectively modulate HGF signaling pathways to promote healing and inhibit tumor growth. The production of recombinant HGFA and HGF also opens avenues for developing reliable diagnostic tools and targeted therapies in regenerative medicine and oncology.
