Analytical Data
-
Gene name
Clusterin-like 蛋白 1/CLUL1
-
简介
Clusterin-like protein 1/CLUL1 Protein belongs to the clusterin family.Clusterin-like protein 1/CLUL1 Protein, Human (HEK293, His) is the recombinant human-derived Clusterin-like protein 1/CLUL1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
rHuClusterin-like protein 1/CLUL1, His; Clusterin-Like Protein 1; Retinal-Specific Clusterin-Like Protein; CLUL1
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15846
-
Expression Region
A21-A442
-
AA Sequence
APTWKDKTAISENLKSFSEVGEIDADEEVKKALTGIKQMKIMMERKEKEHTNLMSTLKKCREEKQEALKLLNEVQEHLEEEERLCRESLADSWGECRSCLENNCMRIYTTCQPSWSSVKNKIERFFRKIYQFLFPFHEDNEKDLPISEKLIEEDAQLTQMEDVFSQLTVDVNSLFNRSFNVFRQMQQEFDQTFQSHFISDTDLTEPYFFPAFSKEPMTKADLEQCWDIPNFFQLFCNFSVSIYESVSETITKMLKAIEDLPKQDKAPDHGGLISKMLPGQDRGLCGELDQNLSRCFKFHEKCQKCQAHLSEDCPDVPALHTELDEAIRLVNVSNQQYGQILQMTRKHLEDTAYLVEKMRGQFGWVSELANQAPETEIIFNSIQVVPRIHEGNISKQDETMMTDLSILPSSNFTLKIPLEESA
-
Protein Length
Partial
-
Molecular Weight
The protein migrates as 59-80 kDa under reducing SDS-PAGE due to glycosylation.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Clusterin-like protein 1 (CLUL1) is a member of the Clusterin family, known for its involvement in various biological processes, including apoptosis, tissue remodeling, and inflammation. Research has increasingly focused on CLUL1 due to its potential roles in disease mechanisms, particularly in cancer and neurodegenerative disorders. CLUL1 expression has been linked to cell survival and immune responses, suggesting it may have a protective role under certain pathological conditions. The recombinant form of CLUL1 is of particular interest for both basic research and therapeutic applications, as it can be utilized to further elucidate its functional properties and interactions within cellular pathways. Producing CLUL1 as a recombinant protein allows scientists to study its structure-function relationship, helping to identify its biochemical activities and how these may contribute to disease progression or protection. Furthermore, understanding the molecular mechanisms of CLUL1 could pave the way for developing novel strategies targeting this protein in various diseases, highlighting its significance in biomedical research. Overall, the study of CLUL1, especially in the context of its recombinant protein form, is crucial for advancing our comprehension of its physiological roles and therapeutic potential.
