Analytical Data
-
Gene name
Collagen Alpha-1(XVIII) Chain/Endostatin
-
简介
Endostatin Protein, Human (P.pastoris) is an endogenous antiangiogenic peptide with multiple antitumor roles through modulation of various receptors in the plasma membrane, such as suppression of angiogenesis and inhibition of tumor-cell migration and invasion.
- Application
-
Alternative Names
rHuEndostatin; Collagen alpha-1(XV) chain
-
Species
Human
-
Source
P. pastoris
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P39060-3
-
Expression Region
A1571-K1754
-
AA Sequence
AHSHRDFQPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK
-
Protein Length
Partial
-
Molecular Weight
16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Collagen Alpha-1(XVIII) Chain, also known as endostatin, is a fragment derived from collagen type XVIII, a protein that plays a crucial role in extracellular matrix organization and tissue maintenance. Research has increasingly focused on endostatin due to its potent anti-angiogenic properties, which make it a promising candidate for cancer therapy. By inhibiting the proliferation of endothelial cells and the formation of new blood vessels, endostatin can effectively disrupt tumor growth and metastasis. Additionally, studies have indicated that this protein may also have roles in regulating tissue repair and fibrosis. The recombinant production of endostatin has facilitated detailed investigations into its biological functions and therapeutic potential. It allows for the generation of high-purity protein for use in preclinical and clinical studies, enabling a better understanding of its mechanisms of action and its potential as a treatment for various diseases, including cancer and age-related disorders. The ongoing exploration of endostatin not only advances our knowledge of angiogenesis but also highlights its significance in the field of regenerative medicine and targeted therapies.











