Analytical Data
-
Gene name
CES3/CES1D
-
简介
CES3/CES1D Protein, a major lipase in white adipose tissue, plays a crucial role in xenobiotic and natural substrate metabolism. It hydrolyzes triacylglycerols and monoacylglycerols, showing a preference for the latter, with susceptibility increasing as the acyl chain length decreases. Additionally, CES3/CES1D catalyzes the synthesis of fatty acid ethyl esters and hydrolyzes retinyl esters. CES3/CES1D Protein, Mouse (HEK293, His) is the recombinant mouse-derived CES3/CES1D protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
rMuCarboxylesterase 1D/CES3, His; CES3; carboxylesterase 3; carboxylesterase 3 (brain); EC 3.1.1; EC 3.1.1.1; ES31FLJ21736; Esterase 31; Liver carboxylesterase 31 homolog
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8VCT4
-
Expression Region
Y19-E561
-
AA Sequence
YPSSPPVVNTVKGKVLGKYVNLEGFTQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTSYPPMCSQDAVGGQVLSELFTNRKENIPLQFSEDCLYLNIYTPADLTKNSRLPVMVWIHGGGLVVGGASTYDGLALSAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIANFGGNPGSVTIFGESAGGFSVSVLVLSPLAKNLFHRAISESGVSLTAALITTDVKPIAGLVATLSGCKTTTSAVMVHCLRQKTEDELLETSLKLNLFKLDLLGNPKESYPFLPTVIDGVVLPKAPEEILAEKSFSTVPYIVGINKQEFGWIIPTLMGYPLAEGKLDQKTANSLLWKSYPTLKISENMIPVVAEKYLGGTDDLTKKKDLFQDLMADVVFGVPSVIVSRSHRDAGASTYMYEFEYRPSFVSAMRPKAVIGDHGDEIFSVFGSPFLKDGASEEETNLSKMVMKFWANFARNGNPNGGGLPHWPEYDQKEGYLKIGASTQAAQRLKDKEVSFWAELRAKESAQRPSHRE
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
58-70 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CES3 (carboxylesterase 3) and CES1D (carboxylesterase 1D) are members of the carboxylesterase enzyme family, which play critical roles in the metabolism of various endogenous compounds and xenobiotics, including drugs and environmental toxins. These enzymes are involved in hydrolyzing ester and amide bonds, thereby facilitating the detoxification and clearance of lipophilic substances from the body. The research on CES3 and CES1D has gained significance due to their implications in pharmacogenomics, as genetic variations in these enzymes can influence drug metabolism, efficacy, and toxicity. For instance, alterations in CES1D activity are associated with the metabolism of several therapeutic agents, such as the opioid analgesic codeine, while CES3 has been implicated in the metabolism of certain pesticides. Furthermore, understanding the structure-function relationships of these enzymes can lead to the development of novel therapeutics and improved drug formulations. The ongoing studies aim to elucidate the biochemical pathways involved in CES3 and CES1D functions, their regulation, and their potential roles in disease states, including cancer and metabolic disorders. As such, researching these carboxylesterases presents an opportunity to enhance our understanding of metabolic processes and improve drug safety and efficacy profiles in clinical settings.
