Cat: IPD-X24014

Recombinant Human BID Protein

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BID

  • 简介

    BID Protein, Human expresses in E. coli. The BH3-only protein BID, a pro-apoptotic member of the Bcl-2 family, was initially discovered through binding to both pro-apoptotic Bax and anti-apoptotic Bcl-2. BID is activated in the BCL-2-regulated or mitochondrial apoptosis pathway and acts as a switch between the extrinsic and intrinsic cell death pathways[1].

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuBID; BH3-Interacting Domain Death Agonist; BID

  • Species

    Human

  • Source

    E. coli

  • Tag

    Tag Free

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P55957

  • Expression Region

    M1-D195

  • AA Sequence

    MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD

  • Protein Length

    Full Length

  • Molecular Weight

    20.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The research on BID (BH3-interacting domain death agonist) recombinant protein stems from its critical role in apoptosis regulation and cellular stress response. BID is a pro-apoptotic member of the Bcl-2 family of proteins, which plays a pivotal role in the intrinsic pathway of apoptosis. Upon activation, BID is cleaved to form a truncated form known as tBID, which translocates to the mitochondria and facilitates the release of cytochrome c, ultimately leading to cell death. Understanding the mechanisms by which BID and its derivatives operate is essential for elucidating how cells balance survival and death in physiological and pathological conditions, including cancer, neurodegeneration, and ischemic injury. Researchers have increasingly focused on the recombinant expression of BID and tBID to study their structure-function relationships, binding affinities with other apoptotic regulators, and potential therapeutic applications. By generating and characterizing BID recombinant proteins, scientists aim to develop novel strategies for manipulating apoptosis in cancer therapies, promoting cell survival in neurodegenerative diseases, and enhancing protective mechanisms against cellular damage. The intricate interplay between BID and other apoptotic mediators highlights its significance as a target in drug design and provides valuable insights into the development of more effective treatment regimens aimed at diseases characterized by dysregulated apoptosis.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US